PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2248s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 180aa    MW: 20624.8 Da    PI: 9.215
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2248s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.71.5e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s
  Cagra.2248s0020.1.p  9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQNGRLYDFAS 59
                         79***********************************************86 PP

2K-box48.44.1e-1783145971
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 
                          ++e+  ++l++e+a + ++i+ Lq   R+++G+dL+s+s++eL++L  q+eksl+ +Rs+K +
  Cagra.2248s0020.1.p  83 QKEQYVQELKREMAIMVNKIDHLQLHCRRVMGQDLDSCSVEELKELTIQIEKSLTIVRSRKPR 145
                          678889******************999**********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-31387IPR002100Transcription factor, MADS-box
CDDcd002654.22E-40370No hitNo description
PRINTSPR004041.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003199.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1486146IPR002487Transcription factor, K-box
PROSITE profilePS512978.788179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ NGRLYDFASS  60
DMTKIMERYE IYRRESFAAE RLQKEQYVQE LKREMAIMVN KIDHLQLHCR RVMGQDLDSC  120
SVEELKELTI QIEKSLTIVR SRKPRNVQES DHKSAASCGS GNMDISDVKT DLFIGLPES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-20372271Myocyte-specific enhancer factor 2A
3mu6_C3e-20372271Myocyte-specific enhancer factor 2A
3mu6_B3e-20372271Myocyte-specific enhancer factor 2A
3mu6_A3e-20372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893093e-66AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282813.11e-130hypothetical protein CARUB_v10006544mg
SwissprotQ9FLH51e-67AGL72_ARATH; MADS-box protein AGL72
TrEMBLR0F2Y01e-130R0F2Y0_9BRAS; Uncharacterized protein
STRINGBra029314.1-P2e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88051235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.21e-70MIKC_MADS family protein